Protein Description: zinc finger, DHHC-type containing 16
Gene Name: ZDHHC16
Alternative Gene Name: APH2
Sequence: LFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHK
Interspecies mouse/rat: ENSMUSG00000025157: 62%, ENSRNOG00000046530: 62%
Entrez Gene ID: 84287
Uniprot ID: Q969W1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZDHHC16
Alternative Gene Name: APH2
Sequence: LFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHK
Interspecies mouse/rat: ENSMUSG00000025157: 62%, ENSRNOG00000046530: 62%
Entrez Gene ID: 84287
Uniprot ID: Q969W1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZDHHC16 (ATL-APrEST89402) | |
| Antibody | Anti ZDHHC16 pAb (ATL-HPA040214 w/enhanced validation) |
| Documents & Links for PrEST Antigen ZDHHC16 (ATL-APrEST89402) | |
| Datasheet | PrEST Antigen ZDHHC16 (ATL-APrEST89402) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZDHHC16 (ATL-APrEST89402) at Atlas |
| Documents & Links for PrEST Antigen ZDHHC16 (ATL-APrEST89402) | |
| Datasheet | PrEST Antigen ZDHHC16 (ATL-APrEST89402) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZDHHC16 (ATL-APrEST89402) |