Protein Description: zinc finger, CW type with PWWP domain 2
Gene Name: ZCWPW2
Alternative Gene Name: ZCW2
Sequence: KLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLL
Interspecies mouse/rat: ENSMUSG00000037108: 27%, ENSRNOG00000053820: 72%
Entrez Gene ID: 152098
Uniprot ID: Q504Y3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZCWPW2
Alternative Gene Name: ZCW2
Sequence: KLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLL
Interspecies mouse/rat: ENSMUSG00000037108: 27%, ENSRNOG00000053820: 72%
Entrez Gene ID: 152098
Uniprot ID: Q504Y3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZCWPW2 (ATL-APrEST90891) | |
| Antibody | Anti ZCWPW2 pAb (ATL-HPA039839) |
| Documents & Links for PrEST Antigen ZCWPW2 (ATL-APrEST90891) | |
| Datasheet | PrEST Antigen ZCWPW2 (ATL-APrEST90891) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZCWPW2 (ATL-APrEST90891) at Atlas |
| Documents & Links for PrEST Antigen ZCWPW2 (ATL-APrEST90891) | |
| Datasheet | PrEST Antigen ZCWPW2 (ATL-APrEST90891) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZCWPW2 (ATL-APrEST90891) |