Protein Description: zinc finger and BTB domain containing 9
Gene Name: ZBTB9
Alternative Gene Name: MGC23166, ZNF919
Sequence: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
Interspecies mouse/rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%
Entrez Gene ID: 221504
Uniprot ID: Q96C00
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB9
Alternative Gene Name: MGC23166, ZNF919
Sequence: DAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQT
Interspecies mouse/rat: ENSMUSG00000079605: 86%, ENSRNOG00000026799: 85%
Entrez Gene ID: 221504
Uniprot ID: Q96C00
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZBTB9 (ATL-APrEST94777) | |
| Antibody | Anti ZBTB9 pAb (ATL-HPA058171) |
| Documents & Links for PrEST Antigen ZBTB9 (ATL-APrEST94777) | |
| Datasheet | PrEST Antigen ZBTB9 (ATL-APrEST94777) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB9 (ATL-APrEST94777) at Atlas |
| Documents & Links for PrEST Antigen ZBTB9 (ATL-APrEST94777) | |
| Datasheet | PrEST Antigen ZBTB9 (ATL-APrEST94777) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB9 (ATL-APrEST94777) |