Protein Description: zinc finger and BTB domain containing 8A
Gene Name: ZBTB8A
Alternative Gene Name: BOZF1, FLJ90065, ZBTB8, ZNF916A
Sequence: SQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYC
Interspecies mouse/rat: ENSMUSG00000028807: 61%, ENSRNOG00000008300: 67%
Entrez Gene ID: 653121
Uniprot ID: Q96BR9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB8A
Alternative Gene Name: BOZF1, FLJ90065, ZBTB8, ZNF916A
Sequence: SQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYC
Interspecies mouse/rat: ENSMUSG00000028807: 61%, ENSRNOG00000008300: 67%
Entrez Gene ID: 653121
Uniprot ID: Q96BR9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZBTB8A (ATL-APrEST88334) | |
| Antibody | Anti ZBTB8A pAb (ATL-HPA031769) |
| Documents & Links for PrEST Antigen ZBTB8A (ATL-APrEST88334) | |
| Datasheet | PrEST Antigen ZBTB8A (ATL-APrEST88334) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB8A (ATL-APrEST88334) at Atlas |
| Documents & Links for PrEST Antigen ZBTB8A (ATL-APrEST88334) | |
| Datasheet | PrEST Antigen ZBTB8A (ATL-APrEST88334) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB8A (ATL-APrEST88334) |