Protein Description: zinc finger and BTB domain containing 6
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Sequence: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
Interspecies mouse/rat: ENSMUSG00000066798: 88%, ENSRNOG00000009340: 86%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Sequence: EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
Interspecies mouse/rat: ENSMUSG00000066798: 88%, ENSRNOG00000009340: 86%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen ZBTB6 (ATL-APrEST93345) | |
Antibody | Anti ZBTB6 pAb (ATL-HPA076894) |
Documents & Links for PrEST Antigen ZBTB6 (ATL-APrEST93345) | |
Datasheet | PrEST Antigen ZBTB6 (ATL-APrEST93345) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB6 (ATL-APrEST93345) at Atlas |
Documents & Links for PrEST Antigen ZBTB6 (ATL-APrEST93345) | |
Datasheet | PrEST Antigen ZBTB6 (ATL-APrEST93345) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB6 (ATL-APrEST93345) |