Protein Description: zinc finger and BTB domain containing 6
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Sequence: CTEPLSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVK
Interspecies mouse/rat: ENSMUSG00000066798: 92%, ENSRNOG00000009340: 89%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Sequence: CTEPLSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVK
Interspecies mouse/rat: ENSMUSG00000066798: 92%, ENSRNOG00000009340: 89%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZBTB6 (ATL-APrEST85837) | |
| Antibody | Anti ZBTB6 pAb (ATL-HPA054111) |
| Documents & Links for PrEST Antigen ZBTB6 (ATL-APrEST85837) | |
| Datasheet | PrEST Antigen ZBTB6 (ATL-APrEST85837) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB6 (ATL-APrEST85837) at Atlas |
| Documents & Links for PrEST Antigen ZBTB6 (ATL-APrEST85837) | |
| Datasheet | PrEST Antigen ZBTB6 (ATL-APrEST85837) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB6 (ATL-APrEST85837) |