Protein Description: zinc finger and BTB domain containing 45
Gene Name: ZBTB45
Alternative Gene Name: FLJ14486, ZNF499
Sequence: APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH
Interspecies mouse/rat: ENSMUSG00000049600: 78%, ENSRNOG00000027459: 80%
Entrez Gene ID: 84878
Uniprot ID: Q96K62
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB45
Alternative Gene Name: FLJ14486, ZNF499
Sequence: APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH
Interspecies mouse/rat: ENSMUSG00000049600: 78%, ENSRNOG00000027459: 80%
Entrez Gene ID: 84878
Uniprot ID: Q96K62
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZBTB45 (ATL-APrEST95315) | |
| Antibody | Anti ZBTB45 pAb (ATL-HPA075485) |
| Documents & Links for PrEST Antigen ZBTB45 (ATL-APrEST95315) | |
| Datasheet | PrEST Antigen ZBTB45 (ATL-APrEST95315) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB45 (ATL-APrEST95315) at Atlas |
| Documents & Links for PrEST Antigen ZBTB45 (ATL-APrEST95315) | |
| Datasheet | PrEST Antigen ZBTB45 (ATL-APrEST95315) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB45 (ATL-APrEST95315) |