PrEST Antigen ZBTB44 (ATL-APrEST85871)

Catalog No:
ATL-APrEST85871-100
$290.00
Protein Description: zinc finger and BTB domain containing 44
Gene Name: ZBTB44
Alternative Gene Name: BTBD15, HSPC063, ZNF851
Sequence: SFGEYKHHMRVSRHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSSDFLVPDYLNQEQEETLVQYDLGEHGFESNSSVQMPVISQYHS
Interspecies mouse/rat: ENSMUSG00000047412: 97%, ENSRNOG00000043223: 27%
Entrez Gene ID: 29068
Uniprot ID:
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Cognate Antibody/Antigen for PrEST Antigen ZBTB44 (ATL-APrEST85871)
Antibody Anti ZBTB44 pAb (ATL-HPA052589)
Documents & Links for PrEST Antigen ZBTB44 (ATL-APrEST85871)
Datasheet PrEST Antigen ZBTB44 (ATL-APrEST85871) Datasheet (External Link)
Vendor Page PrEST Antigen ZBTB44 (ATL-APrEST85871) at Atlas

Documents & Links for PrEST Antigen ZBTB44 (ATL-APrEST85871)
Datasheet PrEST Antigen ZBTB44 (ATL-APrEST85871) Datasheet (External Link)
Vendor Page PrEST Antigen ZBTB44 (ATL-APrEST85871)