Protein Description: zinc finger and BTB domain containing 21
Gene Name: ZBTB21
Alternative Gene Name: KIAA1227, ZNF295
Sequence: PLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Interspecies mouse/rat: ENSMUSG00000046962: 97%, ENSRNOG00000001623: 96%
Entrez Gene ID: 49854
Uniprot ID: Q9ULJ3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB21
Alternative Gene Name: KIAA1227, ZNF295
Sequence: PLEPDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Interspecies mouse/rat: ENSMUSG00000046962: 97%, ENSRNOG00000001623: 96%
Entrez Gene ID: 49854
Uniprot ID: Q9ULJ3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen ZBTB21 (ATL-APrEST90760) | |
Antibody | Anti ZBTB21 pAb (ATL-HPA031757) |
Documents & Links for PrEST Antigen ZBTB21 (ATL-APrEST90760) | |
Datasheet | PrEST Antigen ZBTB21 (ATL-APrEST90760) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB21 (ATL-APrEST90760) at Atlas |
Documents & Links for PrEST Antigen ZBTB21 (ATL-APrEST90760) | |
Datasheet | PrEST Antigen ZBTB21 (ATL-APrEST90760) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB21 (ATL-APrEST90760) |