Protein Description: zinc finger and BTB domain containing 18
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Sequence: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Sequence: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI |
Gene ID - Mouse | ENSMUSG00000063659 |
Gene ID - Rat | ENSRNOG00000004423 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen ZBTB18 (ATL-APrEST95211) | |
Datasheet | PrEST Antigen ZBTB18 (ATL-APrEST95211) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB18 (ATL-APrEST95211) at Atlas |
Documents & Links for PrEST Antigen ZBTB18 (ATL-APrEST95211) | |
Datasheet | PrEST Antigen ZBTB18 (ATL-APrEST95211) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB18 (ATL-APrEST95211) |