Protein Description: zinc finger and BTB domain containing 16
Gene Name: ZBTB16
Alternative Gene Name: PLZF, ZNF145
Sequence: HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Interspecies mouse/rat: ENSMUSG00000066687: 98%, ENSRNOG00000029980: 97%
Entrez Gene ID: 7704
Uniprot ID: Q05516
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB16
Alternative Gene Name: PLZF, ZNF145
Sequence: HYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSA
Interspecies mouse/rat: ENSMUSG00000066687: 98%, ENSRNOG00000029980: 97%
Entrez Gene ID: 7704
Uniprot ID: Q05516
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZBTB16 (ATL-APrEST84745) | |
| Antibody | Anti ZBTB16 pAb (ATL-HPA001499) |
| Documents & Links for PrEST Antigen ZBTB16 (ATL-APrEST84745) | |
| Datasheet | PrEST Antigen ZBTB16 (ATL-APrEST84745) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB16 (ATL-APrEST84745) at Atlas |
| Documents & Links for PrEST Antigen ZBTB16 (ATL-APrEST84745) | |
| Datasheet | PrEST Antigen ZBTB16 (ATL-APrEST84745) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB16 (ATL-APrEST84745) |