Protein Description: zinc finger and BTB domain containing 1
Gene Name: ZBTB1
Alternative Gene Name: KIAA0997, ZNF909
Sequence: MNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSS
Interspecies mouse/rat: ENSMUSG00000033454: 100%, ENSRNOG00000058593: 97%
Entrez Gene ID: 22890
Uniprot ID: Q9Y2K1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB1
Alternative Gene Name: KIAA0997, ZNF909
Sequence: MNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSS
Interspecies mouse/rat: ENSMUSG00000033454: 100%, ENSRNOG00000058593: 97%
Entrez Gene ID: 22890
Uniprot ID: Q9Y2K1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ZBTB1 (ATL-APrEST95287) | |
| Antibody | Anti ZBTB1 pAb (ATL-HPA075151) |
| Documents & Links for PrEST Antigen ZBTB1 (ATL-APrEST95287) | |
| Datasheet | PrEST Antigen ZBTB1 (ATL-APrEST95287) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB1 (ATL-APrEST95287) at Atlas |
| Documents & Links for PrEST Antigen ZBTB1 (ATL-APrEST95287) | |
| Datasheet | PrEST Antigen ZBTB1 (ATL-APrEST95287) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ZBTB1 (ATL-APrEST95287) |