Protein Description: zinc finger, BED-type containing 6
Gene Name: ZBED6
Alternative Gene Name:
Sequence: KFSKDLGSGRPVADAPALLASNDPEQDEESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTS
Interspecies mouse/rat: ENSMUSG00000102049: 95%, ENSRNOG00000061499: 27%
Entrez Gene ID: 100381270
Uniprot ID: P86452
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBED6
Alternative Gene Name:
Sequence: KFSKDLGSGRPVADAPALLASNDPEQDEESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTS
Interspecies mouse/rat: ENSMUSG00000102049: 95%, ENSRNOG00000061499: 27%
Entrez Gene ID: 100381270
Uniprot ID: P86452
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen ZBED6 (ATL-APrEST92819) | |
Antibody | Anti ZBED6 pAb (ATL-HPA068807) |
Documents & Links for PrEST Antigen ZBED6 (ATL-APrEST92819) | |
Datasheet | PrEST Antigen ZBED6 (ATL-APrEST92819) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBED6 (ATL-APrEST92819) at Atlas |
Documents & Links for PrEST Antigen ZBED6 (ATL-APrEST92819) | |
Datasheet | PrEST Antigen ZBED6 (ATL-APrEST92819) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBED6 (ATL-APrEST92819) |