Protein Description: von Willebrand factor A domain containing 5B2
Gene Name: VWA5B2
Alternative Gene Name: DKFZp761K032, LOC90113
Sequence: LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL
Interspecies mouse/rat: ENSMUSG00000046613: 53%, ENSRNOG00000001707: 52%
Entrez Gene ID: 90113
Uniprot ID: Q8N398
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: VWA5B2
Alternative Gene Name: DKFZp761K032, LOC90113
Sequence: LPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGPRRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYL
Interspecies mouse/rat: ENSMUSG00000046613: 53%, ENSRNOG00000001707: 52%
Entrez Gene ID: 90113
Uniprot ID: Q8N398
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen VWA5B2 (ATL-APrEST87916) | |
Antibody | Anti VWA5B2 pAb (ATL-HPA061412) |
Documents & Links for PrEST Antigen VWA5B2 (ATL-APrEST87916) | |
Datasheet | PrEST Antigen VWA5B2 (ATL-APrEST87916) Datasheet (External Link) |
Vendor Page | PrEST Antigen VWA5B2 (ATL-APrEST87916) at Atlas |
Documents & Links for PrEST Antigen VWA5B2 (ATL-APrEST87916) | |
Datasheet | PrEST Antigen VWA5B2 (ATL-APrEST87916) Datasheet (External Link) |
Vendor Page | PrEST Antigen VWA5B2 (ATL-APrEST87916) |