Protein Description: vaccinia related kinase 3
Gene Name: VRK3
Alternative Gene Name:
Sequence: CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
Interspecies mouse/rat: ENSMUSG00000002205: 68%, ENSRNOG00000026517: 73%
Entrez Gene ID: 51231
Uniprot ID: Q8IV63
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: VRK3
Alternative Gene Name:
Sequence: CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
Interspecies mouse/rat: ENSMUSG00000002205: 68%, ENSRNOG00000026517: 73%
Entrez Gene ID: 51231
Uniprot ID: Q8IV63
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen VRK3 (ATL-APrEST91729) | |
Antibody | Anti VRK3 pAb (ATL-HPA056489) |
Documents & Links for PrEST Antigen VRK3 (ATL-APrEST91729) | |
Datasheet | PrEST Antigen VRK3 (ATL-APrEST91729) Datasheet (External Link) |
Vendor Page | PrEST Antigen VRK3 (ATL-APrEST91729) at Atlas |
Documents & Links for PrEST Antigen VRK3 (ATL-APrEST91729) | |
Datasheet | PrEST Antigen VRK3 (ATL-APrEST91729) Datasheet (External Link) |
Vendor Page | PrEST Antigen VRK3 (ATL-APrEST91729) |