Protein Description: UTP20 small subunit (SSU) processome component
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Sequence: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UTP20
Alternative Gene Name: 1A6/DRIM, DRIM
Sequence: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
Interspecies mouse/rat: ENSMUSG00000004356: 81%, ENSRNOG00000005823: 81%
Entrez Gene ID: 27340
Uniprot ID: O75691
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen UTP20 (ATL-APrEST91191) | |
Antibody | Anti UTP20 pAb (ATL-HPA049341) |
Documents & Links for PrEST Antigen UTP20 (ATL-APrEST91191) | |
Datasheet | PrEST Antigen UTP20 (ATL-APrEST91191) Datasheet (External Link) |
Vendor Page | PrEST Antigen UTP20 (ATL-APrEST91191) at Atlas |
Documents & Links for PrEST Antigen UTP20 (ATL-APrEST91191) | |
Datasheet | PrEST Antigen UTP20 (ATL-APrEST91191) Datasheet (External Link) |
Vendor Page | PrEST Antigen UTP20 (ATL-APrEST91191) |