Protein Description: unc-119 lipid binding chaperone B
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Sequence: IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Sequence: IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UNC119B (ATL-APrEST95483) | |
| Antibody | Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) |
| Documents & Links for PrEST Antigen UNC119B (ATL-APrEST95483) | |
| Datasheet | PrEST Antigen UNC119B (ATL-APrEST95483) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UNC119B (ATL-APrEST95483) at Atlas |
| Documents & Links for PrEST Antigen UNC119B (ATL-APrEST95483) | |
| Datasheet | PrEST Antigen UNC119B (ATL-APrEST95483) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UNC119B (ATL-APrEST95483) |