Protein Description: unc-119 lipid binding chaperone B
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Sequence: IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Sequence: IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR |
Gene ID - Mouse | ENSMUSG00000046562 |
Gene ID - Rat | ENSRNOG00000021725 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen UNC119B (ATL-APrEST95483) | |
Datasheet | PrEST Antigen UNC119B (ATL-APrEST95483) Datasheet (External Link) |
Vendor Page | PrEST Antigen UNC119B (ATL-APrEST95483) at Atlas |
Documents & Links for PrEST Antigen UNC119B (ATL-APrEST95483) | |
Datasheet | PrEST Antigen UNC119B (ATL-APrEST95483) Datasheet (External Link) |
Vendor Page | PrEST Antigen UNC119B (ATL-APrEST95483) |