Protein Description: upper zone of growth plate and cartilage matrix associated
Gene Name: UCMA
Alternative Gene Name: C10orf49
Sequence: YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Interspecies mouse/rat: ENSMUSG00000026668: 88%, ENSRNOG00000017987: 88%
Entrez Gene ID: 221044
Uniprot ID: Q8WVF2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UCMA
Alternative Gene Name: C10orf49
Sequence: YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Interspecies mouse/rat: ENSMUSG00000026668: 88%, ENSRNOG00000017987: 88%
Entrez Gene ID: 221044
Uniprot ID: Q8WVF2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UCMA (ATL-APrEST84826) | |
| Antibody | Anti UCMA pAb (ATL-HPA046718) |
| Documents & Links for PrEST Antigen UCMA (ATL-APrEST84826) | |
| Datasheet | PrEST Antigen UCMA (ATL-APrEST84826) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UCMA (ATL-APrEST84826) at Atlas |
| Documents & Links for PrEST Antigen UCMA (ATL-APrEST84826) | |
| Datasheet | PrEST Antigen UCMA (ATL-APrEST84826) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UCMA (ATL-APrEST84826) |