Protein Description: ubiquitin B
Gene Name: UBB
Alternative Gene Name: FLJ25987, MGC8385
Sequence: GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Interspecies mouse/rat: ENSMUSG00000019505: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7314
Uniprot ID: P0CG47
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UBB
Alternative Gene Name: FLJ25987, MGC8385
Sequence: GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Interspecies mouse/rat: ENSMUSG00000019505: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7314
Uniprot ID: P0CG47
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UBB (ATL-APrEST89098) | |
| Antibody | Anti UBB pAb (ATL-HPA049132) |
| Documents & Links for PrEST Antigen UBB (ATL-APrEST89098) | |
| Datasheet | PrEST Antigen UBB (ATL-APrEST89098) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBB (ATL-APrEST89098) at Atlas |
| Documents & Links for PrEST Antigen UBB (ATL-APrEST89098) | |
| Datasheet | PrEST Antigen UBB (ATL-APrEST89098) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBB (ATL-APrEST89098) |