PrEST Antigen UBASH3B, Gene description: ubiquitin associated and SH3 domain containing B, Alternative Gene Names: KIAA1959, STS-1, TULA-2, TULA2, Antigen sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM |
| Gene ID - Mouse | ENSMUSG00000032020 |
| Gene ID - Rat | ENSMUSG00000032020 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen UBASH3B (ATL-APrEST95725) | |
| Vendor Page | PrEST Antigen UBASH3B (ATL-APrEST95725) at Atlas |
| Documents & Links for PrEST Antigen UBASH3B (ATL-APrEST95725) | |
| Vendor Page | PrEST Antigen UBASH3B (ATL-APrEST95725) |