Protein Description: transmembrane protease, serine 15
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Sequence: LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Sequence: LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen TMPRSS15 (ATL-APrEST93995) | |
| Antibody | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) |
| Documents & Links for PrEST Antigen TMPRSS15 (ATL-APrEST93995) | |
| Datasheet | PrEST Antigen TMPRSS15 (ATL-APrEST93995) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS15 (ATL-APrEST93995) at Atlas |
| Documents & Links for PrEST Antigen TMPRSS15 (ATL-APrEST93995) | |
| Datasheet | PrEST Antigen TMPRSS15 (ATL-APrEST93995) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS15 (ATL-APrEST93995) |