PrEST Antigen TIMM50 (ATL-APrEST87757)

Catalog No:
ATL-APrEST87757-100
$290.00
Protein Description: translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
Gene Name: TIMM50
Alternative Gene Name: TIM50L
Sequence: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
Interspecies mouse/rat: ENSMUSG00000003438: 99%, ENSRNOG00000037638: 99%
Entrez Gene ID: 92609
Uniprot ID: Q3ZCQ8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Cognate Antibody/Antigen for PrEST Antigen TIMM50 (ATL-APrEST87757)
Antibody Anti TIMM50 pAb (ATL-HPA056448)
Documents & Links for PrEST Antigen TIMM50 (ATL-APrEST87757)
Datasheet PrEST Antigen TIMM50 (ATL-APrEST87757) Datasheet (External Link)
Vendor Page PrEST Antigen TIMM50 (ATL-APrEST87757) at Atlas

Documents & Links for PrEST Antigen TIMM50 (ATL-APrEST87757)
Datasheet PrEST Antigen TIMM50 (ATL-APrEST87757) Datasheet (External Link)
Vendor Page PrEST Antigen TIMM50 (ATL-APrEST87757)