Protein Description: thymocyte selection associated family member 2
Gene Name: THEMIS2
Alternative Gene Name: C1orf38, ICB-1
Sequence: GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF
Interspecies mouse/rat: ENSMUSG00000037731: 62%, ENSRNOG00000012965: 64%
Entrez Gene ID: 9473
Uniprot ID: Q5TEJ8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: THEMIS2
Alternative Gene Name: C1orf38, ICB-1
Sequence: GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF
Interspecies mouse/rat: ENSMUSG00000037731: 62%, ENSRNOG00000012965: 64%
Entrez Gene ID: 9473
Uniprot ID: Q5TEJ8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF |
Gene ID - Mouse | ENSMUSG00000037731 |
Gene ID - Rat | ENSRNOG00000012965 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen THEMIS2 (ATL-APrEST94589) | |
Datasheet | PrEST Antigen THEMIS2 (ATL-APrEST94589) Datasheet (External Link) |
Vendor Page | PrEST Antigen THEMIS2 (ATL-APrEST94589) at Atlas |
Documents & Links for PrEST Antigen THEMIS2 (ATL-APrEST94589) | |
Datasheet | PrEST Antigen THEMIS2 (ATL-APrEST94589) Datasheet (External Link) |
Vendor Page | PrEST Antigen THEMIS2 (ATL-APrEST94589) |