Protein Description: transcription factor EC
Gene Name: TFEC
Alternative Gene Name: bHLHe34, TCFEC, TFECL
Sequence: AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
Interspecies mouse/rat: ENSMUSG00000029553: 90%, ENSRNOG00000061595: 90%
Entrez Gene ID: 22797
Uniprot ID: O14948
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: TFEC
Alternative Gene Name: bHLHe34, TCFEC, TFECL
Sequence: AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
Interspecies mouse/rat: ENSMUSG00000029553: 90%, ENSRNOG00000061595: 90%
Entrez Gene ID: 22797
Uniprot ID: O14948
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen TFEC (ATL-APrEST92370) | |
| Antibody | Anti TFEC pAb (ATL-HPA063577) |
| Documents & Links for PrEST Antigen TFEC (ATL-APrEST92370) | |
| Datasheet | PrEST Antigen TFEC (ATL-APrEST92370) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TFEC (ATL-APrEST92370) at Atlas |
| Documents & Links for PrEST Antigen TFEC (ATL-APrEST92370) | |
| Datasheet | PrEST Antigen TFEC (ATL-APrEST92370) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TFEC (ATL-APrEST92370) |