Protein Description: TBC1 domain family, member 10A
Gene Name: TBC1D10A
Alternative Gene Name: AC004997.C22.2, EPI64, TBC1D10
Sequence: KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
Interspecies mouse/rat: ENSMUSG00000034412: 65%, ENSRNOG00000006394: 67%
Entrez Gene ID: 83874
Uniprot ID: Q9BXI6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: TBC1D10A
Alternative Gene Name: AC004997.C22.2, EPI64, TBC1D10
Sequence: KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
Interspecies mouse/rat: ENSMUSG00000034412: 65%, ENSRNOG00000006394: 67%
Entrez Gene ID: 83874
Uniprot ID: Q9BXI6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen TBC1D10A (ATL-APrEST93305) | |
Antibody | Anti TBC1D10A pAb (ATL-HPA076041) |
Documents & Links for PrEST Antigen TBC1D10A (ATL-APrEST93305) | |
Datasheet | PrEST Antigen TBC1D10A (ATL-APrEST93305) Datasheet (External Link) |
Vendor Page | PrEST Antigen TBC1D10A (ATL-APrEST93305) at Atlas |
Documents & Links for PrEST Antigen TBC1D10A (ATL-APrEST93305) | |
Datasheet | PrEST Antigen TBC1D10A (ATL-APrEST93305) Datasheet (External Link) |
Vendor Page | PrEST Antigen TBC1D10A (ATL-APrEST93305) |