Protein Description: sperm acrosome associated 7
Gene Name: SPACA7
Alternative Gene Name: C13orf28
Sequence: AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL
Interspecies mouse/rat: ENSMUSG00000010435: 43%, ENSRNOG00000054006: 36%
Entrez Gene ID: 122258
Uniprot ID: Q96KW9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: SPACA7
Alternative Gene Name: C13orf28
Sequence: AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL
Interspecies mouse/rat: ENSMUSG00000010435: 43%, ENSRNOG00000054006: 36%
Entrez Gene ID: 122258
Uniprot ID: Q96KW9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL |
Gene ID - Mouse | ENSMUSG00000010435 |
Gene ID - Rat | ENSRNOG00000054006 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SPACA7 (ATL-APrEST93934) | |
Datasheet | PrEST Antigen SPACA7 (ATL-APrEST93934) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPACA7 (ATL-APrEST93934) at Atlas |
Documents & Links for PrEST Antigen SPACA7 (ATL-APrEST93934) | |
Datasheet | PrEST Antigen SPACA7 (ATL-APrEST93934) Datasheet (External Link) |
Vendor Page | PrEST Antigen SPACA7 (ATL-APrEST93934) |