PrEST Antigen SMLR1 (ATL-APrEST88171)
Atlas Antibodies
- SKU:
- ATL-APrEST88171-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SMLR1
Alternative Gene Name:
Sequence: FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW
Interspecies mouse/rat: ENSMUSG00000096546: 56%, ENSRNOG00000047821: 47%
Entrez Gene ID: 100507203
Uniprot ID: H3BR10
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW |
Gene ID - Mouse | ENSMUSG00000096546 |
Gene ID - Rat | ENSRNOG00000047821 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SMLR1 (ATL-APrEST88171) | |
Datasheet | PrEST Antigen SMLR1 (ATL-APrEST88171) Datasheet (External Link) |
Vendor Page | PrEST Antigen SMLR1 (ATL-APrEST88171) at Atlas Antibodies |
Documents & Links for PrEST Antigen SMLR1 (ATL-APrEST88171) | |
Datasheet | PrEST Antigen SMLR1 (ATL-APrEST88171) Datasheet (External Link) |
Vendor Page | PrEST Antigen SMLR1 (ATL-APrEST88171) |