Protein Description: small integral membrane protein 17
Gene Name: SMIM17
Alternative Gene Name:
Sequence: MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASS
Interspecies mouse/rat: ENSMUSG00000093536: 66%, ENSRNOG00000042502: 64%
Entrez Gene ID: 147670
Uniprot ID: P0DL12
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: SMIM17
Alternative Gene Name:
Sequence: MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASS
Interspecies mouse/rat: ENSMUSG00000093536: 66%, ENSRNOG00000042502: 64%
Entrez Gene ID: 147670
Uniprot ID: P0DL12
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen SMIM17 (ATL-APrEST93040) | |
| Antibody | Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) |
| Documents & Links for PrEST Antigen SMIM17 (ATL-APrEST93040) | |
| Datasheet | PrEST Antigen SMIM17 (ATL-APrEST93040) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SMIM17 (ATL-APrEST93040) at Atlas |
| Documents & Links for PrEST Antigen SMIM17 (ATL-APrEST93040) | |
| Datasheet | PrEST Antigen SMIM17 (ATL-APrEST93040) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SMIM17 (ATL-APrEST93040) |