PrEST Antigen SIK2 (ATL-APrEST95066)
Atlas Antibodies
- SKU:
- ATL-APrEST95066-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: SIK2
Alternative Gene Name: DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2
Sequence: VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI
Interspecies mouse/rat: ENSMUSG00000037112: 89%, ENSRNOG00000043498: 89%
Entrez Gene ID: 23235
Uniprot ID: Q9H0K1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI |
Gene ID - Mouse | ENSMUSG00000037112 |
Gene ID - Rat | ENSRNOG00000043498 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen SIK2 (ATL-APrEST95066) | |
Datasheet | PrEST Antigen SIK2 (ATL-APrEST95066) Datasheet (External Link) |
Vendor Page | PrEST Antigen SIK2 (ATL-APrEST95066) at Atlas Antibodies |
Documents & Links for PrEST Antigen SIK2 (ATL-APrEST95066) | |
Datasheet | PrEST Antigen SIK2 (ATL-APrEST95066) Datasheet (External Link) |
Vendor Page | PrEST Antigen SIK2 (ATL-APrEST95066) |