Protein Description: sterile alpha motif domain containing 4B
Gene Name: SAMD4B
Alternative Gene Name: FLJ10211, hSmaug2, MGC99832, SMGB
Sequence: IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
Interspecies mouse/rat: ENSMUSG00000109336: 79%, ENSRNOG00000019831: 80%
Entrez Gene ID: 55095
Uniprot ID: Q5PRF9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: SAMD4B
Alternative Gene Name: FLJ10211, hSmaug2, MGC99832, SMGB
Sequence: IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
Interspecies mouse/rat: ENSMUSG00000109336: 79%, ENSRNOG00000019831: 80%
Entrez Gene ID: 55095
Uniprot ID: Q5PRF9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen SAMD4B (ATL-APrEST91998) | |
| Antibody | Anti SAMD4B pAb (ATL-HPA059385) |
| Documents & Links for PrEST Antigen SAMD4B (ATL-APrEST91998) | |
| Datasheet | PrEST Antigen SAMD4B (ATL-APrEST91998) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SAMD4B (ATL-APrEST91998) at Atlas |
| Documents & Links for PrEST Antigen SAMD4B (ATL-APrEST91998) | |
| Datasheet | PrEST Antigen SAMD4B (ATL-APrEST91998) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SAMD4B (ATL-APrEST91998) |