Protein Description: ribosomal protein S5
Gene Name: RPS5
Alternative Gene Name: S5
Sequence: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA
Interspecies mouse/rat: ENSMUSG00000012848: 97%, ENSRNOG00000019453: 98%
Entrez Gene ID: 6193
Uniprot ID: P46782
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RPS5
Alternative Gene Name: S5
Sequence: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA
Interspecies mouse/rat: ENSMUSG00000012848: 97%, ENSRNOG00000019453: 98%
Entrez Gene ID: 6193
Uniprot ID: P46782
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen RPS5 (ATL-APrEST84659) | |
| Antibody | Anti RPS5 pAb (ATL-HPA055878 w/enhanced validation) |
| Documents & Links for PrEST Antigen RPS5 (ATL-APrEST84659) | |
| Datasheet | PrEST Antigen RPS5 (ATL-APrEST84659) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RPS5 (ATL-APrEST84659) at Atlas |
| Documents & Links for PrEST Antigen RPS5 (ATL-APrEST84659) | |
| Datasheet | PrEST Antigen RPS5 (ATL-APrEST84659) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RPS5 (ATL-APrEST84659) |