Protein Description: ribosomal protein S19
Gene Name: RPS19
Alternative Gene Name: DBA, S19
Sequence: LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG
Interspecies mouse/rat: ENSMUSG00000040952: 96%, ENSRNOG00000048199: 96%
Entrez Gene ID: 6223
Uniprot ID: P39019
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RPS19
Alternative Gene Name: DBA, S19
Sequence: LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG
Interspecies mouse/rat: ENSMUSG00000040952: 96%, ENSRNOG00000048199: 96%
Entrez Gene ID: 6223
Uniprot ID: P39019
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen RPS19 (ATL-APrEST94244) | |
| Antibody | Anti RPS19 pAb (ATL-HPA063217) |
| Documents & Links for PrEST Antigen RPS19 (ATL-APrEST94244) | |
| Datasheet | PrEST Antigen RPS19 (ATL-APrEST94244) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RPS19 (ATL-APrEST94244) at Atlas |
| Documents & Links for PrEST Antigen RPS19 (ATL-APrEST94244) | |
| Datasheet | PrEST Antigen RPS19 (ATL-APrEST94244) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RPS19 (ATL-APrEST94244) |