Protein Description: ribosomal protein S16
Gene Name: RPS16
Alternative Gene Name: S16
Sequence: MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RPS16
Alternative Gene Name: S16
Sequence: MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen RPS16 (ATL-APrEST86385) | |
Antibody | Anti RPS16 pAb (ATL-HPA064222) |
Documents & Links for PrEST Antigen RPS16 (ATL-APrEST86385) | |
Datasheet | PrEST Antigen RPS16 (ATL-APrEST86385) Datasheet (External Link) |
Vendor Page | PrEST Antigen RPS16 (ATL-APrEST86385) at Atlas |
Documents & Links for PrEST Antigen RPS16 (ATL-APrEST86385) | |
Datasheet | PrEST Antigen RPS16 (ATL-APrEST86385) Datasheet (External Link) |
Vendor Page | PrEST Antigen RPS16 (ATL-APrEST86385) |