Protein Description: required for meiotic nuclear division 5 homolog A
Gene Name: RMND5A
Alternative Gene Name: FLJ13910, GID2, GID2A, p44CTLH, RMD5
Sequence: RELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDT
Interspecies mouse/rat: ENSMUSG00000002222: 100%, ENSRNOG00000028422: 100%
Entrez Gene ID: 64795
Uniprot ID: Q9H871
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RMND5A
Alternative Gene Name: FLJ13910, GID2, GID2A, p44CTLH, RMD5
Sequence: RELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDT
Interspecies mouse/rat: ENSMUSG00000002222: 100%, ENSRNOG00000028422: 100%
Entrez Gene ID: 64795
Uniprot ID: Q9H871
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen RMND5A (ATL-APrEST89912) | |
| Antibody | Anti RMND5A pAb (ATL-HPA060843) |
| Documents & Links for PrEST Antigen RMND5A (ATL-APrEST89912) | |
| Datasheet | PrEST Antigen RMND5A (ATL-APrEST89912) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RMND5A (ATL-APrEST89912) at Atlas |
| Documents & Links for PrEST Antigen RMND5A (ATL-APrEST89912) | |
| Datasheet | PrEST Antigen RMND5A (ATL-APrEST89912) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RMND5A (ATL-APrEST89912) |