Protein Description: regulator of G-protein signaling 19
Gene Name: RGS19
Alternative Gene Name: GAIP, RGSGAIP
Sequence: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC
Interspecies mouse/rat: ENSMUSG00000002458: 86%, ENSRNOG00000016547: 86%
Entrez Gene ID: 10287
Uniprot ID: P49795
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RGS19
Alternative Gene Name: GAIP, RGSGAIP
Sequence: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC
Interspecies mouse/rat: ENSMUSG00000002458: 86%, ENSRNOG00000016547: 86%
Entrez Gene ID: 10287
Uniprot ID: P49795
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen RGS19 (ATL-APrEST92912) | |
Antibody | Anti RGS19 pAb (ATL-HPA056384) |
Documents & Links for PrEST Antigen RGS19 (ATL-APrEST92912) | |
Datasheet | PrEST Antigen RGS19 (ATL-APrEST92912) Datasheet (External Link) |
Vendor Page | PrEST Antigen RGS19 (ATL-APrEST92912) at Atlas |
Documents & Links for PrEST Antigen RGS19 (ATL-APrEST92912) | |
Datasheet | PrEST Antigen RGS19 (ATL-APrEST92912) Datasheet (External Link) |
Vendor Page | PrEST Antigen RGS19 (ATL-APrEST92912) |