Protein Description: RAB8B, member RAS oncogene family
Gene Name: RAB8B
Alternative Gene Name:
Sequence: SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RAB8B
Alternative Gene Name:
Sequence: SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen RAB8B (ATL-APrEST90410) | |
Antibody | Anti RAB8B pAb (ATL-HPA074534) |
Documents & Links for PrEST Antigen RAB8B (ATL-APrEST90410) | |
Datasheet | PrEST Antigen RAB8B (ATL-APrEST90410) Datasheet (External Link) |
Vendor Page | PrEST Antigen RAB8B (ATL-APrEST90410) at Atlas |
Documents & Links for PrEST Antigen RAB8B (ATL-APrEST90410) | |
Datasheet | PrEST Antigen RAB8B (ATL-APrEST90410) Datasheet (External Link) |
Vendor Page | PrEST Antigen RAB8B (ATL-APrEST90410) |