Protein Description: RAB35, member RAS oncogene family
Gene Name: RAB35
Alternative Gene Name: H-ray
Sequence: AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC
Interspecies mouse/rat: ENSMUSG00000029518: 100%, ENSRNOG00000022014: 100%
Entrez Gene ID: 11021
Uniprot ID: Q15286
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RAB35
Alternative Gene Name: H-ray
Sequence: AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRC
Interspecies mouse/rat: ENSMUSG00000029518: 100%, ENSRNOG00000022014: 100%
Entrez Gene ID: 11021
Uniprot ID: Q15286
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen RAB35 (ATL-APrEST85384) | |
| Antibody | Anti RAB35 pAb (ATL-HPA054146) |
| Documents & Links for PrEST Antigen RAB35 (ATL-APrEST85384) | |
| Datasheet | PrEST Antigen RAB35 (ATL-APrEST85384) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB35 (ATL-APrEST85384) at Atlas |
| Documents & Links for PrEST Antigen RAB35 (ATL-APrEST85384) | |
| Datasheet | PrEST Antigen RAB35 (ATL-APrEST85384) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB35 (ATL-APrEST85384) |