PrEST Antigen RAB20 (ATL-APrEST88234)
Atlas Antibodies
- SKU:
- ATL-APrEST88234-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: RAB20
Alternative Gene Name: FLJ20429
Sequence: KTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
Interspecies mouse/rat: ENSMUSG00000031504: 80%, ENSRNOG00000023991: 74%
Entrez Gene ID: 55647
Uniprot ID: Q9NX57
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | KTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA |
Gene ID - Mouse | ENSMUSG00000031504 |
Gene ID - Rat | ENSRNOG00000023991 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen RAB20 (ATL-APrEST88234) | |
Datasheet | PrEST Antigen RAB20 (ATL-APrEST88234) Datasheet (External Link) |
Vendor Page | PrEST Antigen RAB20 (ATL-APrEST88234) at Atlas Antibodies |
Documents & Links for PrEST Antigen RAB20 (ATL-APrEST88234) | |
Datasheet | PrEST Antigen RAB20 (ATL-APrEST88234) Datasheet (External Link) |
Vendor Page | PrEST Antigen RAB20 (ATL-APrEST88234) |