Protein Description: proteasome activator subunit 2
Gene Name: PSME2
Alternative Gene Name: PA28beta
Sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
Interspecies mouse/rat: ENSMUSG00000079197: 93%, ENSRNOG00000019246: 90%
Entrez Gene ID: 5721
Uniprot ID: Q9UL46
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PSME2
Alternative Gene Name: PA28beta
Sequence: IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
Interspecies mouse/rat: ENSMUSG00000079197: 93%, ENSRNOG00000019246: 90%
Entrez Gene ID: 5721
Uniprot ID: Q9UL46
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PSME2 (ATL-APrEST89994) | |
| Antibody | Anti PSME2 pAb (ATL-HPA062661) |
| Documents & Links for PrEST Antigen PSME2 (ATL-APrEST89994) | |
| Datasheet | PrEST Antigen PSME2 (ATL-APrEST89994) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PSME2 (ATL-APrEST89994) at Atlas |
| Documents & Links for PrEST Antigen PSME2 (ATL-APrEST89994) | |
| Datasheet | PrEST Antigen PSME2 (ATL-APrEST89994) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PSME2 (ATL-APrEST89994) |