Protein Description: protein phosphatase 5, catalytic subunit
Gene Name: PPP5C
Alternative Gene Name: PP5, PPP5
Sequence: PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
Interspecies mouse/rat: ENSMUSG00000003099: 100%, ENSRNOG00000016907: 100%
Entrez Gene ID: 5536
Uniprot ID: P53041
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PPP5C
Alternative Gene Name: PP5, PPP5
Sequence: PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
Interspecies mouse/rat: ENSMUSG00000003099: 100%, ENSRNOG00000016907: 100%
Entrez Gene ID: 5536
Uniprot ID: P53041
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen PPP5C (ATL-APrEST87783) | |
Antibody | Anti PPP5C pAb (ATL-HPA056933) |
Documents & Links for PrEST Antigen PPP5C (ATL-APrEST87783) | |
Datasheet | PrEST Antigen PPP5C (ATL-APrEST87783) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP5C (ATL-APrEST87783) at Atlas |
Documents & Links for PrEST Antigen PPP5C (ATL-APrEST87783) | |
Datasheet | PrEST Antigen PPP5C (ATL-APrEST87783) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP5C (ATL-APrEST87783) |