Protein Description: protein phosphatase 2, regulatory subunit B, beta
Gene Name: PPP2R2B
Alternative Gene Name: PR52B, PR55-BETA, SCA12
Sequence: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Interspecies mouse/rat: ENSMUSG00000041769: 100%, ENSRNOG00000018851: 100%
Entrez Gene ID: 5521
Uniprot ID: Q00005
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PPP2R2B
Alternative Gene Name: PR52B, PR55-BETA, SCA12
Sequence: YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNA
Interspecies mouse/rat: ENSMUSG00000041769: 100%, ENSRNOG00000018851: 100%
Entrez Gene ID: 5521
Uniprot ID: Q00005
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen PPP2R2B (ATL-APrEST88962) | |
Antibody | Anti PPP2R2B pAb (ATL-HPA042122) |
Documents & Links for PrEST Antigen PPP2R2B (ATL-APrEST88962) | |
Datasheet | PrEST Antigen PPP2R2B (ATL-APrEST88962) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP2R2B (ATL-APrEST88962) at Atlas |
Documents & Links for PrEST Antigen PPP2R2B (ATL-APrEST88962) | |
Datasheet | PrEST Antigen PPP2R2B (ATL-APrEST88962) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP2R2B (ATL-APrEST88962) |