Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 1C
Gene Name: PPP1R1C
Alternative Gene Name: Inhibitor-1-like
Sequence: PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
Interspecies mouse/rat: ENSMUSG00000034683: 82%, ENSRNOG00000024990: 84%
Entrez Gene ID: 151242
Uniprot ID: Q8WVI7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PPP1R1C
Alternative Gene Name: Inhibitor-1-like
Sequence: PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
Interspecies mouse/rat: ENSMUSG00000034683: 82%, ENSRNOG00000024990: 84%
Entrez Gene ID: 151242
Uniprot ID: Q8WVI7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PPP1R1C (ATL-APrEST84850) | |
| Antibody | Anti PPP1R1C pAb (ATL-HPA055043) |
| Documents & Links for PrEST Antigen PPP1R1C (ATL-APrEST84850) | |
| Datasheet | PrEST Antigen PPP1R1C (ATL-APrEST84850) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PPP1R1C (ATL-APrEST84850) at Atlas |
| Documents & Links for PrEST Antigen PPP1R1C (ATL-APrEST84850) | |
| Datasheet | PrEST Antigen PPP1R1C (ATL-APrEST84850) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PPP1R1C (ATL-APrEST84850) |