PrEST Antigen PPP1R1B (ATL-APrEST87904)
Atlas Antibodies
- SKU:
- ATL-APrEST87904-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Sequence: EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Interspecies mouse/rat: ENSMUSG00000061718: 77%, ENSRNOG00000028404: 75%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG |
Gene ID - Mouse | ENSMUSG00000061718 |
Gene ID - Rat | ENSRNOG00000028404 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen PPP1R1B (ATL-APrEST87904) | |
Datasheet | PrEST Antigen PPP1R1B (ATL-APrEST87904) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP1R1B (ATL-APrEST87904) at Atlas Antibodies |
Documents & Links for PrEST Antigen PPP1R1B (ATL-APrEST87904) | |
Datasheet | PrEST Antigen PPP1R1B (ATL-APrEST87904) Datasheet (External Link) |
Vendor Page | PrEST Antigen PPP1R1B (ATL-APrEST87904) |