Protein Description: protein phosphatase 1, regulatory (inhibitor) subunit 1B
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Sequence: EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Interspecies mouse/rat: ENSMUSG00000061718: 77%, ENSRNOG00000028404: 75%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PPP1R1B
Alternative Gene Name: DARPP-32, FLJ20940
Sequence: EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Interspecies mouse/rat: ENSMUSG00000061718: 77%, ENSRNOG00000028404: 75%
Entrez Gene ID: 84152
Uniprot ID: Q9UD71
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PPP1R1B (ATL-APrEST87904) | |
| Antibody | Anti PPP1R1B pAb (ATL-HPA061142) |
| Documents & Links for PrEST Antigen PPP1R1B (ATL-APrEST87904) | |
| Datasheet | PrEST Antigen PPP1R1B (ATL-APrEST87904) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PPP1R1B (ATL-APrEST87904) at Atlas |
| Documents & Links for PrEST Antigen PPP1R1B (ATL-APrEST87904) | |
| Datasheet | PrEST Antigen PPP1R1B (ATL-APrEST87904) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PPP1R1B (ATL-APrEST87904) |