Protein Description: protein phosphatase 1, regulatory subunit 15B
Gene Name: PPP1R15B
Alternative Gene Name: FLJ14744
Sequence: CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE
Interspecies mouse/rat: ENSMUSG00000046062: 77%, ENSRNOG00000028493: 74%
Entrez Gene ID: 84919
Uniprot ID: Q5SWA1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PPP1R15B
Alternative Gene Name: FLJ14744
Sequence: CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSLLRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE
Interspecies mouse/rat: ENSMUSG00000046062: 77%, ENSRNOG00000028493: 74%
Entrez Gene ID: 84919
Uniprot ID: Q5SWA1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PPP1R15B (ATL-APrEST92121) | |
| Antibody | Anti PPP1R15B pAb (ATL-HPA061088) |
| Documents & Links for PrEST Antigen PPP1R15B (ATL-APrEST92121) | |
| Datasheet | PrEST Antigen PPP1R15B (ATL-APrEST92121) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PPP1R15B (ATL-APrEST92121) at Atlas |
| Documents & Links for PrEST Antigen PPP1R15B (ATL-APrEST92121) | |
| Datasheet | PrEST Antigen PPP1R15B (ATL-APrEST92121) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PPP1R15B (ATL-APrEST92121) |