Protein Description: pleckstrin homology domain containing, family M (with RUN domain) member 1
Gene Name: PLEKHM1
Alternative Gene Name: KIAA0356
Sequence: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR
Interspecies mouse/rat: ENSMUSG00000034247: 94%, ENSRNOG00000028521: 94%
Entrez Gene ID: 9842
Uniprot ID: Q9Y4G2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PLEKHM1
Alternative Gene Name: KIAA0356
Sequence: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR
Interspecies mouse/rat: ENSMUSG00000034247: 94%, ENSRNOG00000028521: 94%
Entrez Gene ID: 9842
Uniprot ID: Q9Y4G2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen PLEKHM1 (ATL-APrEST87338) | |
Antibody | Anti PLEKHM1 pAb (ATL-HPA039473) |
Documents & Links for PrEST Antigen PLEKHM1 (ATL-APrEST87338) | |
Datasheet | PrEST Antigen PLEKHM1 (ATL-APrEST87338) Datasheet (External Link) |
Vendor Page | PrEST Antigen PLEKHM1 (ATL-APrEST87338) at Atlas |
Documents & Links for PrEST Antigen PLEKHM1 (ATL-APrEST87338) | |
Datasheet | PrEST Antigen PLEKHM1 (ATL-APrEST87338) Datasheet (External Link) |
Vendor Page | PrEST Antigen PLEKHM1 (ATL-APrEST87338) |