Protein Description: pleckstrin homology domain containing B2
Gene Name: PLEKHB2
Alternative Gene Name: EVT2, FLJ20783
Sequence: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
Interspecies mouse/rat: ENSMUSG00000026123: 95%, ENSRNOG00000014162: 94%
Entrez Gene ID: 55041
Uniprot ID: Q96CS7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PLEKHB2
Alternative Gene Name: EVT2, FLJ20783
Sequence: YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM
Interspecies mouse/rat: ENSMUSG00000026123: 95%, ENSRNOG00000014162: 94%
Entrez Gene ID: 55041
Uniprot ID: Q96CS7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PLEKHB2 (ATL-APrEST94422) | |
| Antibody | Anti PLEKHB2 pAb (ATL-HPA075014) |
| Documents & Links for PrEST Antigen PLEKHB2 (ATL-APrEST94422) | |
| Datasheet | PrEST Antigen PLEKHB2 (ATL-APrEST94422) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PLEKHB2 (ATL-APrEST94422) at Atlas |
| Documents & Links for PrEST Antigen PLEKHB2 (ATL-APrEST94422) | |
| Datasheet | PrEST Antigen PLEKHB2 (ATL-APrEST94422) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PLEKHB2 (ATL-APrEST94422) |