PrEST Antigen PLCH1 (ATL-APrEST91855)
Atlas Antibodies
- Catalog No.:
- ATL-APrEST91855-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: PLCH1
Alternative Gene Name: DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3
Sequence: ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE
Interspecies mouse/rat: ENSMUSG00000036834: 54%, ENSRNOG00000009955: 54%
Entrez Gene ID: 23007
Uniprot ID: Q4KWH8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | ETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPTKGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGE |
Gene ID - Mouse | ENSMUSG00000036834 |
Gene ID - Rat | ENSRNOG00000009955 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen PLCH1 (ATL-APrEST91855) | |
Datasheet | PrEST Antigen PLCH1 (ATL-APrEST91855) Datasheet (External Link) |
Vendor Page | PrEST Antigen PLCH1 (ATL-APrEST91855) at Atlas Antibodies |
Documents & Links for PrEST Antigen PLCH1 (ATL-APrEST91855) | |
Datasheet | PrEST Antigen PLCH1 (ATL-APrEST91855) Datasheet (External Link) |
Vendor Page | PrEST Antigen PLCH1 (ATL-APrEST91855) |