Protein Description: phospholipase C beta 2
Gene Name: PLCB2
Alternative Gene Name: FLJ38135
Sequence: PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
Interspecies mouse/rat: ENSMUSG00000040061: 77%, ENSRNOG00000058337: 81%
Entrez Gene ID: 5330
Uniprot ID: Q00722
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PLCB2
Alternative Gene Name: FLJ38135
Sequence: PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
Interspecies mouse/rat: ENSMUSG00000040061: 77%, ENSRNOG00000058337: 81%
Entrez Gene ID: 5330
Uniprot ID: Q00722
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PLCB2 (ATL-APrEST95011) | |
| Antibody | Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation) |
| Documents & Links for PrEST Antigen PLCB2 (ATL-APrEST95011) | |
| Datasheet | PrEST Antigen PLCB2 (ATL-APrEST95011) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PLCB2 (ATL-APrEST95011) at Atlas |
| Documents & Links for PrEST Antigen PLCB2 (ATL-APrEST95011) | |
| Datasheet | PrEST Antigen PLCB2 (ATL-APrEST95011) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PLCB2 (ATL-APrEST95011) |