Protein Description: plasminogen activator, urokinase
Gene Name: PLAU
Alternative Gene Name: UPA, URK
Sequence: KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP
Interspecies mouse/rat: ENSMUSG00000021822: 70%, ENSRNOG00000010516: 70%
Entrez Gene ID: 5328
Uniprot ID: P00749
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PLAU
Alternative Gene Name: UPA, URK
Sequence: KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP
Interspecies mouse/rat: ENSMUSG00000021822: 70%, ENSRNOG00000010516: 70%
Entrez Gene ID: 5328
Uniprot ID: P00749
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYP |
Gene ID - Mouse | ENSMUSG00000021822 |
Gene ID - Rat | ENSRNOG00000010516 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen PLAU (ATL-APrEST95050) | |
Datasheet | PrEST Antigen PLAU (ATL-APrEST95050) Datasheet (External Link) |
Vendor Page | PrEST Antigen PLAU (ATL-APrEST95050) at Atlas |
Documents & Links for PrEST Antigen PLAU (ATL-APrEST95050) | |
Datasheet | PrEST Antigen PLAU (ATL-APrEST95050) Datasheet (External Link) |
Vendor Page | PrEST Antigen PLAU (ATL-APrEST95050) |