Protein Description: phosphatidylinositol glycan anchor biosynthesis, class Q
Gene Name: PIGQ
Alternative Gene Name: GPI1, hGPI1
Sequence: YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ
Interspecies mouse/rat: ENSMUSG00000025728: 98%, ENSRNOG00000020140: 98%
Entrez Gene ID: 9091
Uniprot ID: Q9BRB3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PIGQ
Alternative Gene Name: GPI1, hGPI1
Sequence: YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ
Interspecies mouse/rat: ENSMUSG00000025728: 98%, ENSRNOG00000020140: 98%
Entrez Gene ID: 9091
Uniprot ID: Q9BRB3
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PIGQ (ATL-APrEST92144) | |
| Antibody | Anti PIGQ pAb (ATL-HPA061414) |
| Documents & Links for PrEST Antigen PIGQ (ATL-APrEST92144) | |
| Datasheet | PrEST Antigen PIGQ (ATL-APrEST92144) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PIGQ (ATL-APrEST92144) at Atlas |
| Documents & Links for PrEST Antigen PIGQ (ATL-APrEST92144) | |
| Datasheet | PrEST Antigen PIGQ (ATL-APrEST92144) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PIGQ (ATL-APrEST92144) |